PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016453143.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 354aa    MW: 39785.4 Da    PI: 6.5083
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016453143.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.27.9e-1369110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T +E+el++++++  G++ W+ Ia+ ++ gRt++++k+ w++
   XP_016453143.1  69 SFTHQEEELIIKLHATIGSR-WSIIAQQIP-GRTDNEVKNLWNT 110
                      79******************.*********.**********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.31463IPR001005SANT/Myb domain
SuperFamilySSF466897.26E-1914108IPR009057Homeodomain-like
CDDcd001670.003631761No hitNo description
PROSITE profilePS500906.3072061IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-112070IPR009057Homeodomain-like
PROSITE profilePS5129418.04162116IPR017930Myb domain
SMARTSM007172.2E-1066114IPR001005SANT/Myb domain
PfamPF002499.2E-1269110IPR001005SANT/Myb domain
CDDcd001677.01E-869112No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1971116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGRPPCCSDK VHSRRCNWTE EDANTSTFVS KHGIGNWTAM SKKSGTGKCG RSQKNRWSNR  60
LKTDLKEDSF THQEEELIIK LHATIGSRWS IIAQQIPGRT DNEVKNLWNT KLKKKLSAMG  120
IDPVTHKPFS QILTDYGNIG GFPKARTRFV SLNRELKGAF MSTPEQLQHP LERFPNFNSH  180
CVTTIRLQKT ETSEDCFLSN NYDSSNNQPP VDLLSELQAI KFVTEASNNN SPKAIFSYTN  240
PITDCSLSSP LSSSSSSSAS HSLTSNQVNW CDYLLDDVLL PSNFKEQETV NIEEKLVSGT  300
AQEYRQNNAP ATKDFETTLS TKGTSPSSSF VEDMLECEYE MFLNFPGLSE DPFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-201811610108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016453143.10.0PREDICTED: transcription factor MYB35-like
TrEMBLK4BKK50.0K4BKK5_SOLLC; Uncharacterized protein
STRINGSolyc03g113530.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123481922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-47MYB family protein